Pay in 4 interest-free payments of $6.27 Learn more
Ships within 48 hours · Estimated delivery Nov 7 - Nov 12
The tissue morphology was distorted, and neuronal count was still significantly low as compared to Sham groups
Los productos GLP-1 aprobados por la FDA son medicamentos con receta
Major eye bags
Product Attributes CAS # : 218949-48-5 (Tesamorelin) / 170851-70-4 (Ipamorelin) Molecular Formula : C221H366N72O67S (Tesamorelin) / C38H49N9O5 (Ipamorelin) Sequence (AA) : YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (Tesamorelin) / Aib-His-D-2-Nal-D-Phe-Lys-NH2 (Ipamorelin) Molecular Weight : ~5196 g/mol (Tesamorelin) / ~711.9 g/mol (Ipamorelin) PubChem CID : 16137828 (Tesamorelin) / 9831659 (Ipamorelin) Half-Life : ~26-38 minutes (Tesamorelin) / ~2 hours (Ipamorelin) Synonyms : TH9507, Egrifta (Tesamorelin)
US$ 29.74
US$ 25.85
US$ 28.83
US$ 24.00
US$ 21.51
US$ 26.26
US$ 22.76
US$ 24.28
